Recombinant Full Length Human FAM3B Protein, GST-tagged
Cat.No. : | FAM3B-4583HF |
Product Overview : | Human FAM3B full-length ORF ( AAH57829.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | FAM3B (Family With Sequence Similarity 3 Member B) is a Protein Coding gene. Diseases associated with FAM3B include Reticulate Acropigmentation Of Kitamura and Voyeurism. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3C. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 51.59 kDa |
Protein length : | 235 amino acids |
AA Sequence : | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM3B family with sequence similarity 3, member B [ Homo sapiens ] |
Official Symbol | FAM3B |
Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; |
Gene ID | 54097 |
mRNA Refseq | NM_058186 |
Protein Refseq | NP_478066 |
MIM | 608617 |
UniProt ID | P58499 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *
0
Inquiry Basket