Recombinant Human FAM3B protein, His-tagged
Cat.No. : | FAM3B-7846H |
Product Overview : | Recombinant Human FAM3B protein(26-235 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-235 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | YLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | FAM3B |
Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; |
Gene ID | 54097 |
mRNA Refseq | NM_058186 |
Protein Refseq | NP_478066 |
MIM | 608617 |
UniProt ID | P58499 |
◆ Recombinant Proteins | ||
FAM3B-28821TH | Recombinant Human FAM3B, His-tagged | +Inquiry |
FAM3B-2029H | Recombinant Human FAM3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fam3b-1848M | Recombinant Mouse Fam3b protein, His & T7-tagged | +Inquiry |
Fam3b-2938M | Recombinant Mouse Fam3b Protein, Myc/DDK-tagged | +Inquiry |
Fam3b-4247M | Recombinant Mouse Fam3b protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *