Recombinant Full Length Human FAM3D Protein, GST-tagged

• Cat.No.: FAM3D-4588HF
• Product Overview: Human FAM3D full-length ORF ( AAH15359, 26 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 26-224 amino acids
• Description: FAM3D (Family With Sequence Similarity 3 Member D) is a Protein Coding gene. Diseases associated with FAM3D include Narcolepsy. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3A.
• Molecular Mass: 47.63 kDa
• AA Sequence: YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTLCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM3D family with sequence similarity 3, member D [ Homo sapiens ]
• Official Symbol: FAM3D
• Synonyms: FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7
• Gene ID: 131177
• mRNA Refseq: NM_138805
• Protein Refseq: NP_620160
• MIM: 608619
• UniProt ID: Q96BQ1