Recombinant Full Length Human FASTKD1 Protein, GST-tagged

Cat.No. : FASTKD1-4866HF
Product Overview : Human FASTKD1 full-length ORF ( ADZ16033.1, 1 a.a. - 675 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 675 amino acids
Description : FASTKD1 (FAST Kinase Domains 1) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and protein kinase activity. An important paralog of this gene is FASTKD3.
Molecular Mass : 74.3 kDa
AA Sequence : MGKIADIVHRNLETTQDLSSLSVLMVNISSLISRHFQQQLVNKTELLFDTIDSSEVNVAKSIAKFLRNVRYRYQPLLERCNNVFLSNVDHLDLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPASFVKLFVALGPIAGPEEKKQLKSTMLLMSEDLTGEQALAVLGAMGDMESRNSCLIKRVTSVLHKHLDGYKPLELLKITQELTFLHFQRKEFFAKLRELLLSYLKNSFIPTEVSVLVRAISLLPSPHLDEVGISRIEAVLPQCDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLLQKLDHYGRQRLQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQHFMDDINYINVGEIASFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQHLNSYLGILDPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKASVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIFGEVKSCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FASTKD1 FAST kinase domains 1 [ Homo sapiens ]
Official Symbol FASTKD1
Synonyms FASTKD1; FAST kinase domains 1; FAST kinase domain-containing protein 1; FLJ21901; KIAA1800;
Gene ID 79675
mRNA Refseq NM_024622
Protein Refseq NP_078898
MIM 617529
UniProt ID Q53R41

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FASTKD1 Products

Required fields are marked with *

My Review for All FASTKD1 Products

Required fields are marked with *

0
cart-icon