Recombinant Full Length Human FASTKD1 Protein, GST-tagged
Cat.No. : | FASTKD1-4866HF |
Product Overview : | Human FASTKD1 full-length ORF ( ADZ16033.1, 1 a.a. - 675 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 675 amino acids |
Description : | FASTKD1 (FAST Kinase Domains 1) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and protein kinase activity. An important paralog of this gene is FASTKD3. |
Molecular Mass : | 74.3 kDa |
AA Sequence : | MGKIADIVHRNLETTQDLSSLSVLMVNISSLISRHFQQQLVNKTELLFDTIDSSEVNVAKSIAKFLRNVRYRYQPLLERCNNVFLSNVDHLDLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPASFVKLFVALGPIAGPEEKKQLKSTMLLMSEDLTGEQALAVLGAMGDMESRNSCLIKRVTSVLHKHLDGYKPLELLKITQELTFLHFQRKEFFAKLRELLLSYLKNSFIPTEVSVLVRAISLLPSPHLDEVGISRIEAVLPQCDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLLQKLDHYGRQRLQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQHFMDDINYINVGEIASFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQHLNSYLGILDPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKASVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIFGEVKSCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FASTKD1 FAST kinase domains 1 [ Homo sapiens ] |
Official Symbol | FASTKD1 |
Synonyms | FASTKD1; FAST kinase domains 1; FAST kinase domain-containing protein 1; FLJ21901; KIAA1800; |
Gene ID | 79675 |
mRNA Refseq | NM_024622 |
Protein Refseq | NP_078898 |
MIM | 617529 |
UniProt ID | Q53R41 |
◆ Recombinant Proteins | ||
FASTKD1-4866HF | Recombinant Full Length Human FASTKD1 Protein, GST-tagged | +Inquiry |
FASTKD1-11664Z | Recombinant Zebrafish FASTKD1 | +Inquiry |
FASTKD1-3861H | Recombinant Human FASTKD1 Protein, GST-tagged | +Inquiry |
FASTKD1-5688M | Recombinant Mouse FASTKD1 Protein | +Inquiry |
FASTKD1-3122M | Recombinant Mouse FASTKD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASTKD1 Products
Required fields are marked with *
My Review for All FASTKD1 Products
Required fields are marked with *
0
Inquiry Basket