Recombinant Full Length Human FBXO22 Protein, GST-tagged
| Cat.No. : | FBXO22-5026HF |
| Product Overview : | Human FBXO22 full-length ORF ( AAH39024, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 299 amino acids |
| Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and, as a transcriptional target of the tumor protein p53, is thought to be involved in degradation of specific proteins in response to p53 induction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010] |
| Molecular Mass : | 58.63 kDa |
| AA Sequence : | MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXO22 F-box protein 22 [ Homo sapiens ] |
| Official Symbol | FBXO22 |
| Synonyms | FBXO22; F-box protein 22; F box only protein 22; F-box only protein 22; FBX22; FIST domain containing 1; FISTC1; F-box protein FBX22p44; FLJ13986; MGC31799; |
| Gene ID | 26263 |
| mRNA Refseq | NM_012170 |
| Protein Refseq | NP_036302 |
| MIM | 609096 |
| UniProt ID | Q8NEZ5 |
| ◆ Recombinant Proteins | ||
| FBXO22-480H | Recombinant Human FBXO22 Protein, His-tagged | +Inquiry |
| FBXO22-5026HF | Recombinant Full Length Human FBXO22 Protein, GST-tagged | +Inquiry |
| FBXO22-2259C | Recombinant Chicken FBXO22 | +Inquiry |
| FBXO22-1658R | Recombinant Rhesus monkey FBXO22 Protein, His-tagged | +Inquiry |
| FBXO22-3236Z | Recombinant Zebrafish FBXO22 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO22-6304HCL | Recombinant Human FBXO22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO22 Products
Required fields are marked with *
My Review for All FBXO22 Products
Required fields are marked with *
