Recombinant Full Length Human FBXO3 Protein, C-Flag-tagged
Cat.No. : | FBXO3-1461HFL |
Product Overview : | Recombinant Full Length Human FBXO3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FBXO3 F-box protein 3 [ Homo sapiens (human) ] |
Official Symbol | FBXO3 |
Synonyms | FBA; FBX3 |
Gene ID | 26273 |
mRNA Refseq | NM_012175.4 |
Protein Refseq | NP_036307.2 |
MIM | 609089 |
UniProt ID | Q9UK99 |
◆ Recombinant Proteins | ||
FBXO3-3474H | Recombinant Human FBXO3 Protein (Val155-Phe471), N-His tagged | +Inquiry |
FBXO3-5031HF | Recombinant Full Length Human FBXO3 Protein, GST-tagged | +Inquiry |
FBXO3-1660R | Recombinant Rhesus monkey FBXO3 Protein, His-tagged | +Inquiry |
FBXO3-897H | Recombinant Human FBXO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO3-1949R | Recombinant Rat FBXO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO3-6300HCL | Recombinant Human FBXO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO3 Products
Required fields are marked with *
My Review for All FBXO3 Products
Required fields are marked with *
0
Inquiry Basket