Recombinant Full Length Human FBXO32 Protein

Cat.No. : FBXO32-165HF
Product Overview : Recombinant full length Human Fbx32 with a proprietary tag; Predicted MWt 49.21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 210 amino acids
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : Liquid
Molecular Mass : 49.210kDa inclusive of tags
AA Sequence : MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name FBXO32 F-box protein 32 [ Homo sapiens ]
Official Symbol FBXO32
Synonyms FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx
Gene ID 114907
mRNA Refseq NM_148177
Protein Refseq NP_680482
MIM 606604
UniProt ID Q969P5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO32 Products

Required fields are marked with *

My Review for All FBXO32 Products

Required fields are marked with *

0
cart-icon