Recombinant Full Length Human FBXO32 Protein
| Cat.No. : | FBXO32-165HF |
| Product Overview : | Recombinant full length Human Fbx32 with a proprietary tag; Predicted MWt 49.21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 210 amino acids |
| Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | Liquid |
| Molecular Mass : | 49.210kDa inclusive of tags |
| AA Sequence : | MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | FBXO32 F-box protein 32 [ Homo sapiens ] |
| Official Symbol | FBXO32 |
| Synonyms | FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx |
| Gene ID | 114907 |
| mRNA Refseq | NM_148177 |
| Protein Refseq | NP_680482 |
| MIM | 606604 |
| UniProt ID | Q969P5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO32 Products
Required fields are marked with *
My Review for All FBXO32 Products
Required fields are marked with *




