Recombinant Full Length Human FBXO32 Protein, GST-tagged
| Cat.No. : | FBXO32-4670HF |
| Product Overview : | Human FBXO32 full-length ORF ( AAH24030.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 210 amino acids |
| Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011] |
| Molecular Mass : | 48.84 kDa |
| AA Sequence : | MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXO32 F-box protein 32 [ Homo sapiens ] |
| Official Symbol | FBXO32 |
| Synonyms | FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx; atrogin 1; atrogin-1; muscle atrophy F-box protein; FLJ32424; MGC33610; |
| Gene ID | 114907 |
| mRNA Refseq | NM_001242463 |
| Protein Refseq | NP_001229392 |
| MIM | 606604 |
| UniProt ID | Q969P5 |
| ◆ Recombinant Proteins | ||
| FBXO32-237H | Recombinant Human FBXO32 Protein, His-tagged | +Inquiry |
| FBXO32-12796H | Recombinant Human FBXO32, GST-tagged | +Inquiry |
| Fbxo32-4916M | Recombinant Mouse Fbxo32 protein, His&Myc-tagged | +Inquiry |
| FBXO32-165HF | Recombinant Full Length Human FBXO32 Protein | +Inquiry |
| FBXO32-3936H | Recombinant Human FBXO32 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO32-6297HCL | Recombinant Human FBXO32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO32 Products
Required fields are marked with *
My Review for All FBXO32 Products
Required fields are marked with *
