Recombinant Full Length Human FBXO36 Protein, GST-tagged

Cat.No. : FBXO36-4673HF
Product Overview : Human FBXO36 full-length ORF ( AAH33935.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 188 amino acids
Description : Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Molecular Mass : 48.5 kDa
AA Sequence : MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO36 F-box protein 36 [ Homo sapiens ]
Official Symbol FBXO36
Synonyms FBXO36; F-box protein 36; F box only protein 36; F-box only protein 36; Fbx36; FLJ37592; FLJ41090;
Gene ID 130888
mRNA Refseq NM_174899
Protein Refseq NP_777559
MIM 609105
UniProt ID Q8NEA4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO36 Products

Required fields are marked with *

My Review for All FBXO36 Products

Required fields are marked with *

0
cart-icon