Recombinant Full Length human FCHSD2 protein, Flag-tagged
| Cat.No. : | FCHSD2-08HFL | 
| Product Overview : | Recombinant Full Length human FCHSD2 protein,Flag-tagged, was expressed in HEK293T. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | Flag | 
| Description : | Adapter protein that plays a role in endocytosis via clathrin-coated pits. Contributes to the internalization of cell surface receptors, such as integrin ITGB1 and transferrin receptor. Promotes endocytosis of EGFR in cancer cells, and thereby contributes to the down-regulation of EGFR signaling . Recruited to clathrin-coated pits during a mid-to-late stage of assembly, where it is required for normal progress from U-shaped intermediate stage pits to terminal, omega-shaped pits. Binds to membranes enriched in phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 3,4,5-trisphosphate. When bound to membranes, promotes actin polymerization via its interaction with WAS and/or WASL which leads to the activation of the Arp2/3 complex. Does not promote actin polymerisation in the absence of membranes. | 
| Tag : | Flag | 
| Molecular Mass : | 77.6 kDa | 
| AA Sequence : | MQKLASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQ LKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKAR RSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNT FQFLLENSSKVVRDYNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVA REHKNIVHQQRVLNDLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWL KSAMNQVMEELENERWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKV VYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSR SHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRI GVFPSVLVEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANE KSLHAESPGFSQASRHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV myc-FLAG tag  | 
                                
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80°C. | 
| Concentration : | >0.05 μg/μL as determined by microplate BCA method | 
| Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Gene Name | FCHSD2 FCH and double SH3 domains 2 [ Homo sapiens (human) ] | 
| Official Symbol | FCHSD2 | 
| Synonyms | NWK,NWK1,SH3MD3,FCHSD2 | 
| Gene ID | 9873 | 
| mRNA Refseq | NM_014824 | 
| Protein Refseq | NP_055639 | 
| MIM | 617556 | 
| UniProt ID | O94868 | 
| ◆ Recombinant Proteins | ||
| FCHSD2-3194M | Recombinant Mouse FCHSD2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FCHSD2-08HFL | Recombinant Full Length human FCHSD2 protein, Flag-tagged | +Inquiry | 
| FCHSD2-4763HF | Recombinant Full Length Human FCHSD2 Protein, GST-tagged | +Inquiry | 
| FCHSD2-1502R | Recombinant Rhesus Macaque FCHSD2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FCHSD2-311H | Recombinant Human FCHSD2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FCHSD2-6277HCL | Recombinant Human FCHSD2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All FCHSD2 Products
Required fields are marked with *
My Review for All FCHSD2 Products
Required fields are marked with *
  
        
    
      
            