Recombinant Full Length human FCHSD2 protein, Flag-tagged
Cat.No. : | FCHSD2-08HFL |
Product Overview : | Recombinant Full Length human FCHSD2 protein,Flag-tagged, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | Adapter protein that plays a role in endocytosis via clathrin-coated pits. Contributes to the internalization of cell surface receptors, such as integrin ITGB1 and transferrin receptor. Promotes endocytosis of EGFR in cancer cells, and thereby contributes to the down-regulation of EGFR signaling . Recruited to clathrin-coated pits during a mid-to-late stage of assembly, where it is required for normal progress from U-shaped intermediate stage pits to terminal, omega-shaped pits. Binds to membranes enriched in phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 3,4,5-trisphosphate. When bound to membranes, promotes actin polymerization via its interaction with WAS and/or WASL which leads to the activation of the Arp2/3 complex. Does not promote actin polymerisation in the absence of membranes. |
Tag : | Flag |
Molecular Mass : | 77.6 kDa |
AA Sequence : | MQKLASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQ LKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKAR RSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNT FQFLLENSSKVVRDYNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVA REHKNIVHQQRVLNDLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWL KSAMNQVMEELENERWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKV VYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSR SHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRI GVFPSVLVEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANE KSLHAESPGFSQASRHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80°C. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method |
Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Gene Name | FCHSD2 FCH and double SH3 domains 2 [ Homo sapiens (human) ] |
Official Symbol | FCHSD2 |
Synonyms | NWK,NWK1,SH3MD3,FCHSD2 |
Gene ID | 9873 |
mRNA Refseq | NM_014824 |
Protein Refseq | NP_055639 |
MIM | 617556 |
UniProt ID | O94868 |
◆ Recombinant Proteins | ||
FCHSD2-311H | Recombinant Human FCHSD2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCHSD2-4763HF | Recombinant Full Length Human FCHSD2 Protein, GST-tagged | +Inquiry |
Fchsd2-2977M | Recombinant Mouse Fchsd2 Protein, Myc/DDK-tagged | +Inquiry |
FCHSD2-08HFL | Recombinant Full Length human FCHSD2 protein, Flag-tagged | +Inquiry |
FCHSD2-1680R | Recombinant Rhesus monkey FCHSD2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCHSD2-6277HCL | Recombinant Human FCHSD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCHSD2 Products
Required fields are marked with *
My Review for All FCHSD2 Products
Required fields are marked with *