Recombinant Full Length Human FDX1 Protein, GST-tagged
Cat.No. : | FDX1-4776HF |
Product Overview : | Human FDX1 full-length ORF (AAH10284.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 184 amino acids |
Description : | The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. |
Molecular Mass : | 46.64 kDa |
AA Sequence : | MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FDX1 ferredoxin 1 [ Homo sapiens ] |
Official Symbol | FDX1 |
Synonyms | FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D; |
Gene ID | 2230 |
mRNA Refseq | NM_004109 |
Protein Refseq | NP_004100 |
MIM | 103260 |
UniProt ID | P10109 |
◆ Recombinant Proteins | ||
FDX1-4341H | Recombinant Human FDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fdx1-2981M | Recombinant Mouse Fdx1 Protein, Myc/DDK-tagged | +Inquiry |
FDX1-2896B | Recombinant Bovine FDX1 protein, His-tagged | +Inquiry |
FDX1-5805M | Recombinant Mouse FDX1 Protein | +Inquiry |
FDX1-3203M | Recombinant Mouse FDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *