Recombinant Full Length Human FDX1 Protein, GST-tagged

Cat.No. : FDX1-4776HF
Product Overview : Human FDX1 full-length ORF (AAH10284.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 184 amino acids
Description : The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific.
Molecular Mass : 46.64 kDa
AA Sequence : MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FDX1 ferredoxin 1 [ Homo sapiens ]
Official Symbol FDX1
Synonyms FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D;
Gene ID 2230
mRNA Refseq NM_004109
Protein Refseq NP_004100
MIM 103260
UniProt ID P10109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDX1 Products

Required fields are marked with *

My Review for All FDX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon