Recombinant Human FDX1 Protein

Cat.No. : FDX1-4060H
Product Overview : Human FDX1 (NP_004100, 61 a.a. - 184 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 61-184 a.a.
Description : The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq
Form : Liquid
Molecular Mass : 15 kDa
AA Sequence : MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
Endotoxin : < 1.0 EU per 1 microgram of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris-HCl, pH8.0 (10% glycerol)
Gene Name FDX1 ferredoxin 1 [ Homo sapiens ]
Official Symbol FDX1
Synonyms FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D;
Gene ID 2230
mRNA Refseq NM_004109
Protein Refseq NP_004100
MIM 103260
UniProt ID P10109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDX1 Products

Required fields are marked with *

My Review for All FDX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon