Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
61-184 a.a. |
Description : |
The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq |
Form : |
Liquid |
Molecular Mass : |
15 kDa |
AA Sequence : |
MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
Endotoxin : |
< 1.0 EU per 1 microgram of protein (determined by LAL method) |
Purity : |
> 90% by SDS-PAGE |
Applications : |
SDS-PAGE |
Storage : |
Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : |
1 mg/mL |
Storage Buffer : |
In 20 mM Tris-HCl, pH8.0 (10% glycerol) |