Recombinant Full Length Human FERMT3 Protein, GST-tagged
Cat.No. : | FERMT3-4787HF |
Product Overview : | Human FERMT3 full-length ORF ( NP_113659.3, 1 a.a. - 663 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 663 amino acids |
Description : | Kindlins are a small family of proteins that mediate protein-protein interactions involved in integrin activation and thereby have a role in cell adhesion, migration, differentiation, and proliferation. The protein encoded by this gene has a key role in the regulation of hemostasis and thrombosis. This protein may also help maintain the membrane skeleton of erythrocytes. Mutations in this gene cause the autosomal recessive leukocyte adhesion deficiency syndrome-III (LAD-III). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 101.8 kDa |
AA Sequence : | MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FERMT3 fermitin family member 3 [ Homo sapiens ] |
Official Symbol | FERMT3 |
Synonyms | fermitin family member 3; 23151; Ensembl:ENSG00000149781; MGC10966; fermitin family homolog 3;kindlin 3;MIG2-like protein;UNC-112 related protein 2;unc-112-related protein 2; URP2; KIND3; MIG-2; MIG2B; URP2SF; UNC112C |
Gene ID | 83706 |
mRNA Refseq | NM_031471 |
Protein Refseq | NP_113659 |
MIM | 607901 |
UniProt ID | Q86UX7 |
◆ Recombinant Proteins | ||
FERMT3-4787HF | Recombinant Full Length Human FERMT3 Protein, GST-tagged | +Inquiry |
FERMT3-4077H | Recombinant Human FERMT3 Protein, GST-tagged | +Inquiry |
FERMT3-1223H | Recombinant Human FERMT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FERMT3-12846H | Recombinant Human FERMT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FERMT3-6261HCL | Recombinant Human FERMT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FERMT3 Products
Required fields are marked with *
My Review for All FERMT3 Products
Required fields are marked with *