Recombinant Full Length Human FFAR3 Protein

• Cat.No.: FFAR3-4801HF
• Product Overview: Human FFAR3 full-length ORF (ABM82161.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 740 amino acids
• Description: FFAR3 (Free Fatty Acid Receptor 3) is a Protein Coding gene. Among its related pathways are RET signaling and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and lipid binding. An important paralog of this gene is GPR42.
• Form: Liquid
• Molecular Mass: 38.06 kDa
• AA Sequence: MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: FFAR3 free fatty acid receptor 3 [ Homo sapiens ]
• Official Symbol: FFAR3
• Synonyms: FFAR3; free fatty acid receptor 3; G protein coupled receptor 41, GPR41; FFA3R; G protein-coupled receptor 41; G-protein coupled receptor 41; GPR41
• Gene ID: 2865
• mRNA Refseq: NM_005304
• Protein Refseq: NP_005295
• MIM: 603821
• UniProt ID: O14843