Recombinant Human FFAR3 Protein

Cat.No. : FFAR3-4086H
Product Overview : Human FFAR3 full-length ORF (ABM82161.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : FFAR3 (Free Fatty Acid Receptor 3) is a Protein Coding gene. Among its related pathways are RET signaling and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and lipid binding. An important paralog of this gene is GPR42.
Form : Liquid
Molecular Mass : 38.06 kDa
AA Sequence : MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name FFAR3 free fatty acid receptor 3 [ Homo sapiens ]
Official Symbol FFAR3
Synonyms FFAR3; free fatty acid receptor 3; G protein coupled receptor 41, GPR41; FFA3R; G protein-coupled receptor 41; G-protein coupled receptor 41; GPR41;
Gene ID 2865
mRNA Refseq NM_005304
Protein Refseq NP_005295
MIM 603821
UniProt ID O14843

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FFAR3 Products

Required fields are marked with *

My Review for All FFAR3 Products

Required fields are marked with *

0
cart-icon