Recombinant Human FFAR3 Protein
Cat.No. : | FFAR3-4086H |
Product Overview : | Human FFAR3 full-length ORF (ABM82161.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | FFAR3 (Free Fatty Acid Receptor 3) is a Protein Coding gene. Among its related pathways are RET signaling and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and lipid binding. An important paralog of this gene is GPR42. |
Form : | Liquid |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | FFAR3 free fatty acid receptor 3 [ Homo sapiens ] |
Official Symbol | FFAR3 |
Synonyms | FFAR3; free fatty acid receptor 3; G protein coupled receptor 41, GPR41; FFA3R; G protein-coupled receptor 41; G-protein coupled receptor 41; GPR41; |
Gene ID | 2865 |
mRNA Refseq | NM_005304 |
Protein Refseq | NP_005295 |
MIM | 603821 |
UniProt ID | O14843 |
◆ Recombinant Proteins | ||
FFAR3-2320R | Recombinant Rat FFAR3 Protein | +Inquiry |
Ffar3-926M | Recombinant Mouse Ffar3 Protein, His&SUMO-tagged | +Inquiry |
FFAR3-1977R | Recombinant Rat FFAR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FFAR3-4801HF | Recombinant Full Length Human FFAR3 Protein | +Inquiry |
RFL21704MF | Recombinant Full Length Mouse Free Fatty Acid Receptor 3(Ffar3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FFAR3 Products
Required fields are marked with *
My Review for All FFAR3 Products
Required fields are marked with *
0
Inquiry Basket