Recombinant Full Length Human FGD2 Protein, GST-tagged
Cat.No. : | FGD2-4786HF |
Product Overview : | Human FGD2 full-length ORF ( NP_775829.1, 1 a.a. - 655 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 655 amino acids |
Description : | The protein encoded by this gene belongs to a family of guanine nucleotide exchange factors (GEFs) which control cytoskeleton-dependent membrane rearrangements by activating the cell division cycle 42 (CDC42) protein. This gene is expressed in B lymphocytes, macrophages, and dendritic cells. The encoded protein may play a role in leukocyte signaling and vesicle trafficking in antigen-presenting cells in the immune system. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 101.3 kDa |
AA Sequence : | MKGASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSKAFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQADAQKALDMIFSAAQHSNAAITEMERLQDLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGD2 FYVE, RhoGEF and PH domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | FGD2 |
Synonyms | FGD2; FYVE, RhoGEF and PH domain containing 2; ZFYVE4; FYVE, RhoGEF and PH domain-containing protein 2; FGD1 family, member 2; FLJ00276 protein; zinc finger FYVE domain-containing protein 4 |
Gene ID | 221472 |
mRNA Refseq | NM_173558 |
Protein Refseq | NP_775829 |
MIM | 605091 |
UniProt ID | Q7Z6J4 |
◆ Recombinant Proteins | ||
Fgd2-2991M | Recombinant Mouse Fgd2 Protein, Myc/DDK-tagged | +Inquiry |
FGD2-1513R | Recombinant Rhesus Macaque FGD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGD2-5832M | Recombinant Mouse FGD2 Protein | +Inquiry |
FGD2-2709H | Recombinant Human FGD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FGD2-4089H | Recombinant Human FGD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGD2-6254HCL | Recombinant Human FGD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGD2 Products
Required fields are marked with *
My Review for All FGD2 Products
Required fields are marked with *