Recombinant Full Length Human FGF1 Protein, GST-tagged

Cat.No. : FGF1-4807HF
Product Overview : Human FGF1 full-length ORF ( NP_000791.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 155 amino acids
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
Molecular Mass : 43.9 kDa
AA Sequence : MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
Official Symbol FGF1
Synonyms FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha;
Gene ID 2246
mRNA Refseq NM_000800
Protein Refseq NP_000791
MIM 131220
UniProt ID P05230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF1 Products

Required fields are marked with *

My Review for All FGF1 Products

Required fields are marked with *

0
cart-icon