Recombinant Full Length Human FGF1 Protein, GST-tagged
Cat.No. : | FGF1-4807HF |
Product Overview : | Human FGF1 full-length ORF ( NP_000791.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 155 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
Gene ID | 2246 |
mRNA Refseq | NM_000800 |
Protein Refseq | NP_000791 |
MIM | 131220 |
UniProt ID | P05230 |
◆ Recombinant Proteins | ||
FGF1-2902H | Recombinant Human FGF1 protein, His-SUMO-tagged | +Inquiry |
FGF1-6735C | Recombinant Chicken FGF1 | +Inquiry |
FGF1-1692R | Recombinant Rhesus monkey FGF1 Protein, His-tagged | +Inquiry |
FGF1-26204TH | Recombinant Human FGF1, His-tagged | +Inquiry |
Fgf1-257R | Recombinant Rat Fgf1 protein | +Inquiry |
◆ Native Proteins | ||
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *