Recombinant Full Length Human FGF12 Protein, GST-tagged

Cat.No. : FGF12-4809HF
Product Overview : Human FGF12 full-length ORF ( AAH22524, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 181 amino acids
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Molecular Mass : 45.65 kDa
AA Sequence : MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGF12 fibroblast growth factor 12 [ Homo sapiens ]
Official Symbol FGF12
Synonyms FGF12; fibroblast growth factor 12; FGF12B; FHF1; fibroblast growth factor 12B; fibroblast growth factor FGF 12b; fibroblast growth factor homologous factor 1; myocyte activating factor; FHF-1; FGF-12; myocyte-activating factor; fibroblast growth factor FGF-12b;
Gene ID 2257
mRNA Refseq NM_004113
Protein Refseq NP_004104
MIM 601513
UniProt ID P61328

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF12 Products

Required fields are marked with *

My Review for All FGF12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon