Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Join NIH Research Festival Biotech Vendor Exhibits 2024 | Sep. 25th, 2024

Recombinant Full Length Human FGF13 Protein

Cat.No. : FGF13-168HF
Product Overview : Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 52.690kDa inclusive of tags
Protein length : 245 amino acids
AA Sequence : MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : FGF13 fibroblast growth factor 13 [ Homo sapiens ]
Official Symbol : FGF13
Synonyms : FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2
Gene ID : 2258
mRNA Refseq : NM_001139498
Protein Refseq : NP_001132970
MIM : 300070
UniProt ID : Q92913

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF13 Products

Required fields are marked with *

My Review for All FGF13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends