Recombinant Full Length Human FGF13 Protein, Flag-tagged
Cat.No. : | FGF13-3100HFL |
Product Overview : | Recombinant Full Length Human FGF13 Protein, fused to Flag-tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked cognitive disability mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MALLRKSYSEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYL AMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAH FLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade after receiving vials. |
Concentration : | >0.05 µg/µL as determined by microplate Bradford method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Protein Pathways : | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | FGF13 fibroblast growth factor 13 [ Homo sapiens (human) ] |
Official Symbol | FGF13 |
Synonyms | FGF2; FHF2; DEE90; FHF-2; FGF-13; XLID110; LINC00889 |
Gene ID | 2258 |
mRNA Refseq | NM_033642.3 |
Protein Refseq | NP_378668.1 |
MIM | 300070 |
UniProt ID | Q92913 |
◆ Recombinant Proteins | ||
FGF13-106H | Active Recombinant Human FGF13 Protein (Met1-Thr245), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF13-1695R | Recombinant Rhesus monkey FGF13 Protein, His-tagged | +Inquiry |
FGF13-3228M | Recombinant Mouse FGF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF13-1517R | Recombinant Rhesus Macaque FGF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF13-12863H | Recombinant Human FGF13, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF13-6248HCL | Recombinant Human FGF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF13 Products
Required fields are marked with *
My Review for All FGF13 Products
Required fields are marked with *
0
Inquiry Basket