Recombinant Full Length Human FGF16 Protein, GST-tagged

Cat.No. : FGF16-4813HF
Product Overview : Human FGF16 full-length ORF ( NP_003859.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 207 amino acids
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. [provided by RefSeq
Molecular Mass : 50.2 kDa
AA Sequence : MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGF16 fibroblast growth factor 16 [ Homo sapiens ]
Official Symbol FGF16
Synonyms FGF16; fibroblast growth factor 16; FGF-16;
Gene ID 8823
mRNA Refseq NM_003868
Protein Refseq NP_003859
MIM 300827
UniProt ID O43320

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF16 Products

Required fields are marked with *

My Review for All FGF16 Products

Required fields are marked with *

0
cart-icon