Recombinant Full Length Human FGFBP2 Protein, GST-tagged
| Cat.No. : | FGFBP2-4842HF |
| Product Overview : | Human FGFBP2 full-length ORF ( NP_114156.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 223 amino acids |
| Description : | This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff |
| Molecular Mass : | 51 kDa |
| AA Sequence : | MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens ] |
| Official Symbol | FGFBP2 |
| Synonyms | FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP; |
| Gene ID | 83888 |
| mRNA Refseq | NM_031950 |
| Protein Refseq | NP_114156 |
| MIM | 607713 |
| UniProt ID | Q9BYJ0 |
| ◆ Recombinant Proteins | ||
| FGFBP2-909H | Recombinant Human FGFBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFBP2-1525R | Recombinant Rhesus Macaque FGFBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFBP2-1230HFL | Recombinant Full Length Human FGFBP2 Protein, C-Flag-tagged | +Inquiry |
| FGFBP2-4119H | Recombinant Human FGFBP2 Protein, GST-tagged | +Inquiry |
| FGFBP2-1703R | Recombinant Rhesus monkey FGFBP2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFBP2-6232HCL | Recombinant Human FGFBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFBP2 Products
Required fields are marked with *
My Review for All FGFBP2 Products
Required fields are marked with *
