Recombinant Full Length Human FGFBP2 Protein, GST-tagged

Cat.No. : FGFBP2-4842HF
Product Overview : Human FGFBP2 full-length ORF ( NP_114156.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 223 amino acids
Description : This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff
Molecular Mass : 51 kDa
AA Sequence : MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens ]
Official Symbol FGFBP2
Synonyms FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP;
Gene ID 83888
mRNA Refseq NM_031950
Protein Refseq NP_114156
MIM 607713
UniProt ID Q9BYJ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFBP2 Products

Required fields are marked with *

My Review for All FGFBP2 Products

Required fields are marked with *

0
cart-icon