Recombinant Full Length Human FHL2 Protein, GST-tagged

Cat.No. : FHL2-4958HF
Product Overview : Human FHL2 full-length ORF ( AAH14397, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 279 amino acids
Description : LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
Molecular Mass : 56.43 kDa
AA Sequence : MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FHL2 four and a half LIM domains 2 [ Homo sapiens ]
Official Symbol FHL2
Synonyms FHL2; four and a half LIM domains 2; four and a half LIM domains protein 2; DRAL; SLIM3; LIM domain protein DRAL; aging-associated gene 11; skeletal muscle LIM-protein 3; four and a half LIM-domain protein 2; down-regulated in rhabdomyosarcoma LIM protein; AAG11; FHL-2; SLIM-3;
Gene ID 2274
mRNA Refseq NM_001039492
Protein Refseq NP_001034581
MIM 602633
UniProt ID Q14192

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FHL2 Products

Required fields are marked with *

My Review for All FHL2 Products

Required fields are marked with *

0
cart-icon