Recombinant Full Length Human FKBP14 Protein, GST-tagged
Cat.No. : | FKBP14-4792HF |
Product Overview : | Human FKBP14 full-length ORF ( NP_060416.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012] |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP14 FK506 binding protein 14, 22 kDa [ Homo sapiens ] |
Official Symbol | FKBP14 |
Synonyms | FKBP14; FK506 binding protein 14, 22 kDa; FK506 binding protein 14 (22 kDa); peptidyl-prolyl cis-trans isomerase FKBP14; FKBP22; FLJ20731; FKBP-22; rotamase; 22 kDa FKBP; PPIase FKBP14; FK506-binding protein 14; 22 kDa FK506-binding protein; EDSKMH; |
Gene ID | 55033 |
mRNA Refseq | NM_017946 |
Protein Refseq | NP_060416 |
MIM | 614505 |
UniProt ID | Q9NWM8 |
◆ Recombinant Proteins | ||
FKBP14-2229H | Recombinant Human FKBP14 Protein, MYC/DDK-tagged | +Inquiry |
FKBP14-2953H | Recombinant Human FKBP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP14-5902M | Recombinant Mouse FKBP14 Protein | +Inquiry |
FKBP14-28911TH | Recombinant Human FKBP14, His-tagged | +Inquiry |
FKBP14-4805H | Recombinant Human FKBP14 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP14-1149HCL | Recombinant Human FKBP14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP14 Products
Required fields are marked with *
My Review for All FKBP14 Products
Required fields are marked with *
0
Inquiry Basket