Recombinant Full Length Human FKBP14 Protein, GST-tagged
| Cat.No. : | FKBP14-4792HF | 
| Product Overview : | Human FKBP14 full-length ORF ( NP_060416.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 211 amino acids | 
| Description : | The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012] | 
| Molecular Mass : | 50.6 kDa | 
| AA Sequence : | MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FKBP14 FK506 binding protein 14, 22 kDa [ Homo sapiens ] | 
| Official Symbol | FKBP14 | 
| Synonyms | FKBP14; FK506 binding protein 14, 22 kDa; FK506 binding protein 14 (22 kDa); peptidyl-prolyl cis-trans isomerase FKBP14; FKBP22; FLJ20731; FKBP-22; rotamase; 22 kDa FKBP; PPIase FKBP14; FK506-binding protein 14; 22 kDa FK506-binding protein; EDSKMH; | 
| Gene ID | 55033 | 
| mRNA Refseq | NM_017946 | 
| Protein Refseq | NP_060416 | 
| MIM | 614505 | 
| UniProt ID | Q9NWM8 | 
| ◆ Recombinant Proteins | ||
| FKBP14-2229H | Recombinant Human FKBP14 Protein, MYC/DDK-tagged | +Inquiry | 
| FKBP14-5902M | Recombinant Mouse FKBP14 Protein | +Inquiry | 
| FKBP14-2574H | Recombinant Human FK506 Binding Protein 14, 22 kDa, His-tagged | +Inquiry | 
| FKBP14-570H | Recombinant Human FKBP14, His tagged | +Inquiry | 
| FKBP14-28911TH | Recombinant Human FKBP14, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FKBP14-1149HCL | Recombinant Human FKBP14 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP14 Products
Required fields are marked with *
My Review for All FKBP14 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            