Recombinant Full Length Human FKBP2 Protein, GST-tagged
Cat.No. : | FKBP2-4802HF |
Product Overview : | Human FKBP2 full-length ORF ( NP_004461.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 142 amino acids |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq |
Molecular Mass : | 42 kDa |
AA Sequence : | MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP2 FK506 binding protein 2, 13kDa [ Homo sapiens ] |
Official Symbol | FKBP2 |
Synonyms | FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13; |
Gene ID | 2286 |
mRNA Refseq | NM_001135208 |
Protein Refseq | NP_001128680 |
MIM | 186946 |
UniProt ID | P26885 |
◆ Recombinant Proteins | ||
FKBP2-2033H | Recombinant Human FK506 Binding Protein 2, 13kDa, His-tagged | +Inquiry |
FKBP2-5906M | Recombinant Mouse FKBP2 Protein | +Inquiry |
FKBP2-1542R | Recombinant Rhesus Macaque FKBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP2-1720R | Recombinant Rhesus monkey FKBP2 Protein, His-tagged | +Inquiry |
FKBP2-4188H | Recombinant Human FKBP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP2 Products
Required fields are marked with *
My Review for All FKBP2 Products
Required fields are marked with *