Recombinant Human FKBP2 Protein, His-tagged

• Cat.No.: FKBP2-794H
• Product Overview: Recombinant Human FKBP2, transcript variant 2, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• Form: Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mm NaCl, pH7.5
• Molecular Mass: 14.3kD
• AA Sequence: ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: FKBP2 FK506 binding protein 2, 13kDa [ Homo sapiens ]
• Official Symbol: FKBP2
• Synonyms: FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13
• Gene ID: 2286
• mRNA Refseq: NM_001135208
• Protein Refseq: NP_001128680
• MIM: 186946
• UniProt ID: P26885