Recombinant Human FKBP2 Protein, His-tagged
Cat.No. : | FKBP2-794H |
Product Overview : | Recombinant Human FKBP2, transcript variant 2, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mm NaCl, pH7.5 |
Molecular Mass : | 14.3kD |
AA Sequence : | ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | FKBP2 FK506 binding protein 2, 13kDa [ Homo sapiens ] |
Official Symbol | FKBP2 |
Synonyms | FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13; |
Gene ID | 2286 |
mRNA Refseq | NM_001135208 |
Protein Refseq | NP_001128680 |
MIM | 186946 |
UniProt ID | P26885 |
◆ Recombinant Proteins | ||
FKBP2-794H | Recombinant Human FKBP2 Protein, His-tagged | +Inquiry |
FKBP2-4188H | Recombinant Human FKBP2 Protein, GST-tagged | +Inquiry |
Fkbp2-3025M | Recombinant Mouse Fkbp2 Protein, Myc/DDK-tagged | +Inquiry |
FKBP2-2033H | Recombinant Human FK506 Binding Protein 2, 13kDa, His-tagged | +Inquiry |
FKBP2-734H | Recombinant Human FKBP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP2 Products
Required fields are marked with *
My Review for All FKBP2 Products
Required fields are marked with *
0
Inquiry Basket