Recombinant Full Length Human FKBP3 Protein, GST-tagged
Cat.No. : | FKBP3-4804HF |
Product Overview : | Human FKBP3 full-length ORF ( AAH16288, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 224 amino acids |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq |
Molecular Mass : | 50.38 kDa |
AA Sequence : | MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKEKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
Official Symbol | FKBP3 |
Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25; |
Gene ID | 2287 |
mRNA Refseq | NM_002013 |
Protein Refseq | NP_002004 |
MIM | 186947 |
UniProt ID | Q00688 |
◆ Recombinant Proteins | ||
FKBP3-373H | Recombinant Human FKBP3 | +Inquiry |
FKBP3-28917TH | Recombinant Human FKBP3, His-tagged | +Inquiry |
RFL36981RF | Recombinant Full Length Rhizopus Oryzae Fk506-Binding Protein 2B(Fkbp3) Protein, His-Tagged | +Inquiry |
FKBP3-28915TH | Recombinant Human FKBP3 | +Inquiry |
RFL26959DF | Recombinant Full Length Dictyostelium Discoideum Fk506-Binding Protein 3(Fkbp3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *