Recombinant Human FKBP3
| Cat.No. : | FKBP3-28915TH |
| Product Overview : | Recombinant full length Human FKBP25; amino acids 1-224, Predicted mwt: 25 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-224 a.a. |
| Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAE HKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISK VSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAK PSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKK GQPDAKIPPNAKLTFEVELVDID |
| Full Length : | Full L. |
| Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
| Official Symbol | FKBP3 |
| Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; |
| Gene ID | 2287 |
| mRNA Refseq | NM_002013 |
| Protein Refseq | NP_002004 |
| MIM | 186947 |
| Uniprot ID | Q00688 |
| Chromosome Location | 14q21.2 |
| Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
| Function | FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| FKBP3-373H | Recombinant Human FKBP3 | +Inquiry |
| FKBP3-2188C | Recombinant Cattle FKBP3 Protein, His-tagged | +Inquiry |
| Fkbp3-1266M | Recombinant Mouse Fkbp3 protein, His-tagged | +Inquiry |
| FKBP3-12912H | Recombinant Human FKBP3, GST-tagged | +Inquiry |
| FKBP3-4190H | Recombinant Human FKBP3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *
