Recombinant Human FKBP3

Cat.No. : FKBP3-28915TH
Product Overview : Recombinant full length Human FKBP25; amino acids 1-224, Predicted mwt: 25 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-224 a.a.
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAE HKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISK VSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAK PSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKK GQPDAKIPPNAKLTFEVELVDID
Full Length : Full L.
Gene Name FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol FKBP3
Synonyms FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase;
Gene ID 2287
mRNA Refseq NM_002013
Protein Refseq NP_002004
MIM 186947
Uniprot ID Q00688
Chromosome Location 14q21.2
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP3 Products

Required fields are marked with *

My Review for All FKBP3 Products

Required fields are marked with *

0
cart-icon