Recombinant Full Length Human FKBP8 Protein, GST-tagged

Cat.No. : FKBP8-4818HF
Product Overview : Human FKBP8 full-length ORF ( AAH09966, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 355 amino acids
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. [provided by RefSeq
Molecular Mass : 64.79 kDa
AA Sequence : MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGPVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRRRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP8 FK506 binding protein 8, 38kDa [ Homo sapiens ]
Official Symbol FKBP8
Synonyms FKBP8; FK506 binding protein 8, 38kDa; FK506 binding protein 8 (38kD); peptidyl-prolyl cis-trans isomerase FKBP8; FKBP38; FKBPr38; FKBP-8; FKBP-38; hFKBP38; rotamase; 38 kDa FKBP; PPIase FKBP8; 38 kDa FK506-binding protein; FK506-binding protein 8 (38kD);
Gene ID 23770
mRNA Refseq NM_012181
Protein Refseq NP_036313
MIM 604840
UniProt ID Q14318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP8 Products

Required fields are marked with *

My Review for All FKBP8 Products

Required fields are marked with *

0
cart-icon