Recombinant Full Length Human FLYWCH2 Protein, GST-tagged
Cat.No. : | FLYWCH2-4975HF |
Product Overview : | Human FLYWCH2 full-length ORF ( ADR82776.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 140 amino acids |
Description : | FLYWCH2 (FLYWCH Family Member 2) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FLYWCH1. |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLYWCH2 FLYWCH family member 2 [ Homo sapiens ] |
Official Symbol | FLYWCH2 |
Synonyms | FLYWCH2; FLYWCH family member 2; |
Gene ID | 114984 |
mRNA Refseq | NM_001142499 |
Protein Refseq | NP_001135971 |
UniProt ID | Q96CP2 |
◆ Recombinant Proteins | ||
FLYWCH2-4384H | Recombinant Human FLYWCH2 Protein, GST-tagged | +Inquiry |
Flywch2-3048M | Recombinant Mouse Flywch2 Protein, Myc/DDK-tagged | +Inquiry |
FLYWCH2-1729R | Recombinant Rhesus monkey FLYWCH2 Protein, His-tagged | +Inquiry |
FLYWCH2-3145H | Recombinant Human FLYWCH2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FLYWCH2-4975HF | Recombinant Full Length Human FLYWCH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLYWCH2-6184HCL | Recombinant Human FLYWCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLYWCH2 Products
Required fields are marked with *
My Review for All FLYWCH2 Products
Required fields are marked with *