Recombinant Human FLYWCH2 Protein, GST-tagged

• Cat.No.: FLYWCH2-4384H
• Product Overview: Human FLYWCH2 full-length ORF ( ADR82776.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FLYWCH2 (FLYWCH Family Member 2) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FLYWCH1.
• Molecular Mass: 15.4 kDa
• AA Sequence: MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLYWCH2 FLYWCH family member 2 [ Homo sapiens ]
• Official Symbol: FLYWCH2
• Synonyms: FLYWCH2; FLYWCH family member 2
• Gene ID: 114984
• mRNA Refseq: NM_001142499
• Protein Refseq: NP_001135971
• UniProt ID: Q96CP2