Recombinant Human FLYWCH2 Protein, GST-tagged

Cat.No. : FLYWCH2-4384H
Product Overview : Human FLYWCH2 full-length ORF ( ADR82776.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FLYWCH2 (FLYWCH Family Member 2) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FLYWCH1.
Molecular Mass : 15.4 kDa
AA Sequence : MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLYWCH2 FLYWCH family member 2 [ Homo sapiens ]
Official Symbol FLYWCH2
Synonyms FLYWCH2; FLYWCH family member 2;
Gene ID 114984
mRNA Refseq NM_001142499
Protein Refseq NP_001135971
UniProt ID Q96CP2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLYWCH2 Products

Required fields are marked with *

My Review for All FLYWCH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon