Recombinant Full Length Human FMNL2 Protein, GST-tagged
Cat.No. : | FMNL2-4984HF |
Product Overview : | Human FMNL2 full-length ORF ( AAH36492, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined. [provided by RefSeq |
Molecular Mass : | 45.32 kDa |
AA Sequence : | MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FMNL2 formin-like 2 [ Homo sapiens ] |
Official Symbol | FMNL2 |
Synonyms | FMNL2; formin-like 2; FHOD2, formin homology 2 domain containing 2; formin-like protein 2; KIAA1902; formin homology 2 domain containing 2; formin homology 2 domain-containing protein 2; FHOD2; FLJ37546; |
Gene ID | 114793 |
mRNA Refseq | NM_052905 |
Protein Refseq | NP_443137 |
MIM | 616285 |
UniProt ID | Q96PY5 |
◆ Recombinant Proteins | ||
FMNL2-3287M | Recombinant Mouse FMNL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FMNL2-4984HF | Recombinant Full Length Human FMNL2 Protein, GST-tagged | +Inquiry |
FMNL2-4390H | Recombinant Human FMNL2 Protein, GST-tagged | +Inquiry |
Fmnl2-3051M | Recombinant Mouse Fmnl2 Protein, Myc/DDK-tagged | +Inquiry |
FMNL2-2431H | Recombinant Human FMNL2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMNL2 Products
Required fields are marked with *
My Review for All FMNL2 Products
Required fields are marked with *