Recombinant Full Length Human FNDC5 Protein, GST-tagged
Cat.No. : | FNDC5-5009HF |
Product Overview : | Human FNDC5 full-length ORF ( NP_715637.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 137 amino acids |
Description : | This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ] |
Official Symbol | FNDC5 |
Synonyms | FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2; |
Gene ID | 252995 |
mRNA Refseq | NM_001171940 |
Protein Refseq | NP_001165411 |
MIM | 611906 |
UniProt ID | Q8NAU1 |
◆ Recombinant Proteins | ||
FNDC5-134H | Recombinant Human FNDC5 Protein | +Inquiry |
FNDC5-2839H | Recombinant Human FNDC5 Protein (Asp32-Glu143), C-Fc tagged | +Inquiry |
FNDC5-542H | Active Recombinant Human FNDC5 protein, His-tagged | +Inquiry |
FNDC5-08R | Recombinant Rat FNDC5 Protein, His/S-tagged | +Inquiry |
FNDC5-7845H | Recombinant Human FNDC5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC5 Products
Required fields are marked with *
My Review for All FNDC5 Products
Required fields are marked with *