Recombinant Full Length Human FOPNL Protein, GST-tagged
Cat.No. : | FOPNL-5038HF |
Product Overview : | Human FOPNL full-length ORF ( NP_653201.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 174 amino acids |
Description : | FOPNL (FGFR1OP N-Terminal Like) is a Protein Coding gene. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOPNL FGFR1OP N-terminal like [ Homo sapiens ] |
Official Symbol | FOPNL |
Synonyms | FOR20; C16orf63; PHSECRG2 |
Gene ID | 123811 |
mRNA Refseq | NM_144600 |
Protein Refseq | NP_653201 |
MIM | 617149 |
UniProt ID | Q96NB1 |
◆ Recombinant Proteins | ||
FOPNL-4423H | Recombinant Human FOPNL Protein, GST-tagged | +Inquiry |
FOPNL-5970M | Recombinant Mouse FOPNL Protein | +Inquiry |
FOPNL-3309M | Recombinant Mouse FOPNL Protein, His (Fc)-Avi-tagged | +Inquiry |
FOPNL-5038HF | Recombinant Full Length Human FOPNL Protein, GST-tagged | +Inquiry |
FOPNL-1320C | Recombinant Chicken FOPNL | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOPNL-8248HCL | Recombinant Human C16orf63 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOPNL Products
Required fields are marked with *
My Review for All FOPNL Products
Required fields are marked with *