Recombinant Full Length Human FOPNL Protein, GST-tagged

Cat.No. : FOPNL-5038HF
Product Overview : Human FOPNL full-length ORF ( NP_653201.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 174 amino acids
Description : FOPNL (FGFR1OP N-Terminal Like) is a Protein Coding gene.
Molecular Mass : 46.2 kDa
AA Sequence : MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOPNL FGFR1OP N-terminal like [ Homo sapiens ]
Official Symbol FOPNL
Synonyms FOR20; C16orf63; PHSECRG2
Gene ID 123811
mRNA Refseq NM_144600
Protein Refseq NP_653201
MIM 617149
UniProt ID Q96NB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOPNL Products

Required fields are marked with *

My Review for All FOPNL Products

Required fields are marked with *

0
cart-icon
0
compare icon