Recombinant Full Length Human FOPNL Protein, GST-tagged

• Cat.No.: FOPNL-5038HF
• Product Overview: Human FOPNL full-length ORF ( NP_653201.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 174 amino acids
• Description: FOPNL (FGFR1OP N-Terminal Like) is a Protein Coding gene.
• Molecular Mass: 46.2 kDa
• AA Sequence: MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOPNL FGFR1OP N-terminal like [ Homo sapiens ]
• Official Symbol: FOPNL
• Synonyms: FOR20; C16orf63; PHSECRG2
• Gene ID: 123811
• mRNA Refseq: NM_144600
• Protein Refseq: NP_653201
• MIM: 617149
• UniProt ID: Q96NB1