Recombinant Full Length Human FOSL1 Protein, GST-tagged
Cat.No. : | FOSL1-5042HF |
Product Overview : | Human FOSL1 full-length ORF ( AAH16648.1, 1 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 271 amino acids |
Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq |
Molecular Mass : | 55.44 kDa |
AA Sequence : | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOSL1 FOS-like antigen 1 [ Homo sapiens ] |
Official Symbol | FOSL1 |
Synonyms | FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1; |
Gene ID | 8061 |
mRNA Refseq | NM_005438 |
Protein Refseq | NP_005429 |
MIM | 136515 |
UniProt ID | P15407 |
◆ Recombinant Proteins | ||
Fosl1-1623R | Recombinant Rat Fosl1 protein, His & GST-tagged | +Inquiry |
FOSL1-4427H | Recombinant Human FOSL1 Protein, GST-tagged | +Inquiry |
Fosl1-1622M | Recombinant Mouse Fosl1 protein, His & T7-tagged | +Inquiry |
FOSL1-1034H | Active Recombinant Human FOS-like Antigen 1 | +Inquiry |
FOSL1-5606H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *