Recombinant Full Length Human FOXA1 Protein, C-Flag-tagged
Cat.No. : | FOXA1-269HFL |
Product Overview : | Recombinant Full Length Human FOXA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49 kDa |
AA Sequence : | MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS, Transcription Factors |
Full Length : | Full L. |
Gene Name | FOXA1 forkhead box A1 [ Homo sapiens (human) ] |
Official Symbol | FOXA1 |
Synonyms | HNF3A; TCF3A |
Gene ID | 3169 |
mRNA Refseq | NM_004496.5 |
Protein Refseq | NP_004487.2 |
MIM | 602294 |
UniProt ID | P55317 |
◆ Recombinant Proteins | ||
FOXA1-3739H | Recombinant Human FOXA1 protein, His-tagged | +Inquiry |
FOXA1-8876Z | Recombinant Zebrafish FOXA1 | +Inquiry |
FOXA1-126H | Recombinant Human FOXA1 | +Inquiry |
FOXA1-410H | Recombinant Human FOXA1 Protein, His-tagged | +Inquiry |
FOXA1-4430H | Recombinant Human FOXA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXA1-6164HCL | Recombinant Human FOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXA1 Products
Required fields are marked with *
My Review for All FOXA1 Products
Required fields are marked with *
0
Inquiry Basket