Recombinant Full Length Human FOXA2 Protein, GST-tagged
Cat.No. : | FOXA2-5046HF |
Product Overview : | Human FOXA2 full-length ORF ( NP_068556.1, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 457 amino acids |
Description : | This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 74.7 kDa |
AA Sequence : | MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXA2 forkhead box A2 [ Homo sapiens ] |
Official Symbol | FOXA2 |
Synonyms | FOXA2; forkhead box A2; hepatocyte nuclear factor 3, beta, HNF3B; hepatocyte nuclear factor 3-beta; HNF-3B; TCF-3B; HNF-3-beta; forkhead box protein A2; transcription factor 3B; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3, beta; HNF3B; TCF3B; MGC19807; |
Gene ID | 3170 |
mRNA Refseq | NM_021784 |
Protein Refseq | NP_068556 |
MIM | 600288 |
UniProt ID | Q9Y261 |
◆ Recombinant Proteins | ||
FOXA2-8588Z | Recombinant Zebrafish FOXA2 | +Inquiry |
FOXA2-5976M | Recombinant Mouse FOXA2 Protein | +Inquiry |
FOXA2-2383R | Recombinant Rat FOXA2 Protein | +Inquiry |
FOXA2-28944TH | Recombinant Human FOXA2 | +Inquiry |
FOXA2-4433H | Recombinant Human FOXA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXA2-6163HCL | Recombinant Human FOXA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXA2 Products
Required fields are marked with *
My Review for All FOXA2 Products
Required fields are marked with *