Recombinant Full Length Human FOXF1 Protein, GST-tagged
Cat.No. : | FOXF1-5060HF |
Product Overview : | Human FOXF1 full-length ORF ( ACE87508.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 354 amino acids |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq |
Molecular Mass : | 65.34 kDa |
AA Sequence : | MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXF1 forkhead box F1 [ Homo sapiens ] |
Official Symbol | FOXF1 |
Synonyms | FOXF1; forkhead box F1; FKHL5; forkhead box protein F1; FREAC1; FREAC-1; forkhead-related activator 1; forkhead-related protein FKHL5; Forkhead, drosophila, homolog-like 5; forkhead-related transcription factor 1; ACDMPV; MGC105125; |
Gene ID | 2294 |
mRNA Refseq | NM_001451 |
Protein Refseq | NP_001442 |
MIM | 601089 |
UniProt ID | Q12946 |
◆ Recombinant Proteins | ||
Foxf1-1518M | Recombinant Mouse Foxf1 Protein, His&GST-tagged | +Inquiry |
FOXF1-511H | Recombinant Human FOXF1 | +Inquiry |
FOXF1-5060HF | Recombinant Full Length Human FOXF1 Protein, GST-tagged | +Inquiry |
FOXF1-2968H | Recombinant Human FOXF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXF1-5043Z | Recombinant Zebrafish FOXF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXF1-6157HCL | Recombinant Human FOXF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXF1 Products
Required fields are marked with *
My Review for All FOXF1 Products
Required fields are marked with *