Recombinant Full Length Human FOXF1 Protein, GST-tagged

• Cat.No.: FOXF1-5060HF
• Product Overview: Human FOXF1 full-length ORF ( ACE87508.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 354 amino acids
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq
• Molecular Mass: 65.34 kDa
• AA Sequence: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXF1 forkhead box F1 [ Homo sapiens ]
• Official Symbol: FOXF1
• Synonyms: FOXF1; forkhead box F1; FKHL5; forkhead box protein F1; FREAC1; FREAC-1; forkhead-related activator 1; forkhead-related protein FKHL5; Forkhead, drosophila, homolog-like 5; forkhead-related transcription factor 1; ACDMPV; MGC105125
• Gene ID: 2294
• mRNA Refseq: NM_001451
• Protein Refseq: NP_001442
• MIM: 601089
• UniProt ID: Q12946