Recombinant Full Length Human FRZB protein, His tagged
Cat.No. : | FRZB-001H |
Product Overview : | Recombinant Full Length Human frizzled related protein (33-325 aa) with His tag was expressed in HEK293. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 33-325 aa |
Description : | The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. |
Molecular Mass : | 34 kDa |
AA Sequence : | AACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARNHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | FRZB frizzled related protein [ Homo sapiens (human) ] |
Official Symbol | FRZB |
Synonyms | FRZB; frizzled-related protein; secreted frizzled-related protein 3; FRE; FRITZ; FRP 3; FRZB 1; FRZB PEN; FRZB1; FZRB; hFIZ; SFRP3; SRFP3; sFRP-3; frezzled; frizzled homolog-related; frizzled-related protein 1; OS1; FRP-3; FRZB-1; FRZB-PEN |
Gene ID | 2487 |
mRNA Refseq | NM_001463 |
Protein Refseq | NP_001454 |
MIM | 605083 |
UniProt ID | Q92765 |
◆ Recombinant Proteins | ||
MYOZ3-2928R | Recombinant Rhesus monkey MYOZ3 Protein, His-tagged | +Inquiry |
MYOZ3-2747R | Recombinant Rhesus Macaque MYOZ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOZ3-3567H | Recombinant Human MYOZ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRZB-208H | Active Recombinant Human FRZB, His-tagged | +Inquiry |
FRZB-209H | Active Recombinant Human FRZB | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRZB-873HCL | Recombinant Human FRZB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOZ3 Products
Required fields are marked with *
My Review for All MYOZ3 Products
Required fields are marked with *