Recombinant Full Length Human FRZB protein, His tagged

Cat.No. : FRZB-001H
Product Overview : Recombinant Full Length Human frizzled related protein (33-325 aa) with His tag was expressed in HEK293.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 33-325 aa
Description : The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.
Molecular Mass : 34 kDa
AA Sequence : AACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARNHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name FRZB frizzled related protein [ Homo sapiens (human) ]
Official Symbol FRZB
Synonyms FRZB; frizzled-related protein; secreted frizzled-related protein 3; FRE; FRITZ; FRP 3; FRZB 1; FRZB PEN; FRZB1; FZRB; hFIZ; SFRP3; SRFP3; sFRP-3; frezzled; frizzled homolog-related; frizzled-related protein 1; OS1; FRP-3; FRZB-1; FRZB-PEN
Gene ID 2487
mRNA Refseq NM_001463
Protein Refseq NP_001454
MIM 605083
UniProt ID Q92765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOZ3 Products

Required fields are marked with *

My Review for All MYOZ3 Products

Required fields are marked with *

0
cart-icon