Recombinant Full Length Human FRZB protein, His tagged

• Cat.No.: FRZB-001H
• Product Overview: Recombinant Full Length Human frizzled related protein (33-325 aa) with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 33-325 aa
• Description: The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.
• Molecular Mass: 34 kDa
• AA Sequence: AACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARNHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: FRZB frizzled related protein [ Homo sapiens (human) ]
• Official Symbol: FRZB
• Synonyms: FRZB; frizzled-related protein; secreted frizzled-related protein 3; FRE; FRITZ; FRP 3; FRZB 1; FRZB PEN; FRZB1; FZRB; hFIZ; SFRP3; SRFP3; sFRP-3; frezzled; frizzled homolog-related; frizzled-related protein 1; OS1; FRP-3; FRZB-1; FRZB-PEN
• Gene ID: 2487
• mRNA Refseq: NM_001463
• Protein Refseq: NP_001454
• MIM: 605083
• UniProt ID: Q92765