Recombinant Full Length Human FTHL17 Protein, C-Flag-tagged
Cat.No. : | FTHL17-1864HFL |
Product Overview : | Recombinant Full Length Human FTHL17 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21 kDa |
AA Sequence : | MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | FTHL17 ferritin heavy chain like 17 [ Homo sapiens (human) ] |
Official Symbol | FTHL17 |
Synonyms | CT38 |
Gene ID | 53940 |
mRNA Refseq | NM_031894.3 |
Protein Refseq | NP_114100.1 |
MIM | 300308 |
UniProt ID | Q9BXU8 |
◆ Recombinant Proteins | ||
FTHL17-943H | Recombinant Human FTHL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTHL17-410H | Recombinant Human FTHL17 | +Inquiry |
FTHL17-6111H | Recombinant Human FTHL17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FTHL17-1578R | Recombinant Rhesus Macaque FTHL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTHL17-1757R | Recombinant Rhesus monkey FTHL17 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTHL17-6127HCL | Recombinant Human FTHL17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTHL17 Products
Required fields are marked with *
My Review for All FTHL17 Products
Required fields are marked with *