Recombinant Full Length Human FTHL17 Protein, C-Flag-tagged

• Cat.No.: FTHL17-1864HFL
• Product Overview: Recombinant Full Length Human FTHL17 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 21 kDa
• AA Sequence: MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: FTHL17 ferritin heavy chain like 17 [ Homo sapiens (human) ]
• Official Symbol: FTHL17
• Synonyms: CT38
• Gene ID: 53940
• mRNA Refseq: NM_031894.3
• Protein Refseq: NP_114100.1
• MIM: 300308
• UniProt ID: Q9BXU8