Recombinant Full Length Human FTHL17 Protein, C-Flag-tagged
| Cat.No. : | FTHL17-1864HFL | 
| Product Overview : | Recombinant Full Length Human FTHL17 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 21 kDa | 
| AA Sequence : | MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET myc-FLAG tag | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Transmembrane | 
| Full Length : | Full L. | 
| Gene Name | FTHL17 ferritin heavy chain like 17 [ Homo sapiens (human) ] | 
| Official Symbol | FTHL17 | 
| Synonyms | CT38 | 
| Gene ID | 53940 | 
| mRNA Refseq | NM_031894.3 | 
| Protein Refseq | NP_114100.1 | 
| MIM | 300308 | 
| UniProt ID | Q9BXU8 | 
| ◆ Recombinant Proteins | ||
| FTHL17-410H | Recombinant Human FTHL17 | +Inquiry | 
| FTHL17-6111H | Recombinant Human FTHL17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| FTHL17-943H | Recombinant Human FTHL17 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FTHL17-1864HFL | Recombinant Full Length Human FTHL17 Protein, C-Flag-tagged | +Inquiry | 
| FTHL17-1578R | Recombinant Rhesus Macaque FTHL17 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FTHL17-6127HCL | Recombinant Human FTHL17 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTHL17 Products
Required fields are marked with *
My Review for All FTHL17 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            