Recombinant Full Length Human FTHL17 Protein, C-Flag-tagged

Cat.No. : FTHL17-1864HFL
Product Overview : Recombinant Full Length Human FTHL17 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 21 kDa
AA Sequence : MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name FTHL17 ferritin heavy chain like 17 [ Homo sapiens (human) ]
Official Symbol FTHL17
Synonyms CT38
Gene ID 53940
mRNA Refseq NM_031894.3
Protein Refseq NP_114100.1
MIM 300308
UniProt ID Q9BXU8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTHL17 Products

Required fields are marked with *

My Review for All FTHL17 Products

Required fields are marked with *

0
cart-icon
0
compare icon