Recombinant Full Length Human FXC1 Protein, GST-tagged

Cat.No. : FXC1-5270HF
Product Overview : Human FXC1 full-length ORF ( AAH11014, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 103 amino acids
Description : FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
Molecular Mass : 37.07 kDa
AA Sequence : MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASTVPSVAAEQPGVSPSGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FXC1 fracture callus 1 homolog (rat) [ Homo sapiens ]
Official Symbol FXC1
Synonyms FXC1; fracture callus 1 homolog (rat); fracture callus 1 (rat) homolog; mitochondrial import inner membrane translocase subunit Tim9 B; Tim9b; TIM10B; TIMM10B; fracture callus protein 1;
Gene ID 26515
mRNA Refseq NM_012192
Protein Refseq NP_036324
MIM 607388
UniProt ID Q9Y5J6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXC1 Products

Required fields are marked with *

My Review for All FXC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon