Recombinant Full Length Human FXC1 Protein, GST-tagged
| Cat.No. : | FXC1-5270HF |
| Product Overview : | Human FXC1 full-length ORF ( AAH11014, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 103 amino acids |
| Description : | FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASTVPSVAAEQPGVSPSGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FXC1 fracture callus 1 homolog (rat) [ Homo sapiens ] |
| Official Symbol | FXC1 |
| Synonyms | FXC1; fracture callus 1 homolog (rat); fracture callus 1 (rat) homolog; mitochondrial import inner membrane translocase subunit Tim9 B; Tim9b; TIM10B; TIMM10B; fracture callus protein 1; |
| Gene ID | 26515 |
| mRNA Refseq | NM_012192 |
| Protein Refseq | NP_036324 |
| MIM | 607388 |
| UniProt ID | Q9Y5J6 |
| ◆ Recombinant Proteins | ||
| FXC1-3397M | Recombinant Mouse FXC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FXC1-6099M | Recombinant Mouse FXC1 Protein | +Inquiry |
| FXC1-4574H | Recombinant Human FXC1 Protein, GST-tagged | +Inquiry |
| FXC1-5270HF | Recombinant Full Length Human FXC1 Protein, GST-tagged | +Inquiry |
| FXC1-13050H | Recombinant Human FXC1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXC1-6109HCL | Recombinant Human FXC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXC1 Products
Required fields are marked with *
My Review for All FXC1 Products
Required fields are marked with *
