Recombinant Full Length Human FXYD6 Protein, GST-tagged
| Cat.No. : | FXYD6-5280HF |
| Product Overview : | Human FXYD6 full-length ORF ( AAH18652, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 95 amino acids |
| Description : | This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and has not been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same protein isoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu. |
| Molecular Mass : | 36.19 kDa |
| AA Sequence : | MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FXYD6 FXYD domain containing ion transport regulator 6 [ Homo sapiens (human) ] |
| Official Symbol | FXYD6 |
| Synonyms | FXYD6; FXYD domain containing ion transport regulator 6; FXYD domain-containing ion transport regulator 6; phosphohippolin; FXYD Domain Containing Ion Transport Regulator 6; Phosphohippolin; FXYD Domain-Containing Ion Transport Regulator 6 |
| Gene ID | 53826 |
| mRNA Refseq | NM_001164831 |
| Protein Refseq | NP_001158303 |
| MIM | 606683 |
| UniProt ID | Q9H0Q3 |
| ◆ Recombinant Proteins | ||
| FXYD6-3404M | Recombinant Mouse FXYD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FXYD6-3680H | Recombinant Human FXYD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FXYD6-6108M | Recombinant Mouse FXYD6 Protein | +Inquiry |
| FXYD6-276C | Recombinant Cynomolgus Monkey FXYD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fxyd6-3115M | Recombinant Mouse Fxyd6 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD6-6097HCL | Recombinant Human FXYD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD6 Products
Required fields are marked with *
My Review for All FXYD6 Products
Required fields are marked with *
