Recombinant Full Length Human FYTTD1 Protein, GST-tagged
Cat.No. : | FYTTD1-5067HF |
Product Overview : | Human FYTTD1 full-length ORF ( NP_115664.2, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 318 amino acids |
Description : | FYTTD1 (Forty-Two-Three Domain Containing 1) is a Protein Coding gene. Among its related pathways are Gene Expression and Transport of Mature Transcript to Cytoplasm. GO annotations related to this gene include poly(A) RNA binding and mRNA binding. |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FYTTD1 forty-two-three domain containing 1 [ Homo sapiens ] |
Official Symbol | FYTTD1 |
Synonyms | FYTTD1; forty-two-three domain containing 1; UAP56-interacting factor; DKFZp761B1514; UAP56 interacting factor; UIF; protein 40-2-3; forty-two-three domain-containing protein 1; |
Gene ID | 84248 |
mRNA Refseq | NM_001011537 |
Protein Refseq | NP_001011537 |
MIM | 616933 |
UniProt ID | Q96QD9 |
◆ Recombinant Proteins | ||
FYTTD1-6113M | Recombinant Mouse FYTTD1 Protein | +Inquiry |
FYTTD1-2970C | Recombinant Chicken FYTTD1 | +Inquiry |
FYTTD1-2428R | Recombinant Rat FYTTD1 Protein | +Inquiry |
FYTTD1-4588H | Recombinant Human FYTTD1 Protein, GST-tagged | +Inquiry |
FYTTD1-5067HF | Recombinant Full Length Human FYTTD1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FYTTD1-6090HCL | Recombinant Human FYTTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FYTTD1 Products
Required fields are marked with *
My Review for All FYTTD1 Products
Required fields are marked with *