Recombinant Full Length Human GAB1 Protein, C-Flag-tagged
Cat.No. : | GAB1-1266HFL |
Product Overview : | Recombinant Full Length Human GAB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 79.8 kDa |
AA Sequence : | MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTIGDFATRRKVK PAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLAL KSTREAWTDGRQSTESETPAKSVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | ErbB signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma |
Full Length : | Full L. |
Gene Name | GAB1 GRB2 associated binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | GAB1 |
Synonyms | DFNB26 |
Gene ID | 2549 |
mRNA Refseq | NM_207123.3 |
Protein Refseq | NP_997006.1 |
MIM | 604439 |
UniProt ID | Q13480 |
◆ Recombinant Proteins | ||
GAB1-1606R | Recombinant Rhesus Macaque GAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GAB1-7855H | Recombinant Human GAB1 protein, GST-tagged | +Inquiry |
GAB1-1450H | Recombinant Human GRB2-associated Binding Protein 1, His-tagged | +Inquiry |
GAB1-5128HF | Recombinant Full Length Human GAB1 Protein, GST-tagged | +Inquiry |
GAB1-1785R | Recombinant Rhesus monkey GAB1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAB1-6075HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
GAB1-6076HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAB1 Products
Required fields are marked with *
My Review for All GAB1 Products
Required fields are marked with *
0
Inquiry Basket