Recombinant Full Length Human GADD45A Protein, GST-tagged
Cat.No. : | GADD45A-5206HF |
Product Overview : | Human GADD45A full-length ORF ( AAH11757.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 165 amino acids |
Description : | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ] |
Official Symbol | GADD45A |
Synonyms | GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; |
Gene ID | 1647 |
mRNA Refseq | NM_001199741 |
Protein Refseq | NP_001186670 |
MIM | 126335 |
UniProt ID | P24522 |
◆ Recombinant Proteins | ||
GADD45A-1993H | Recombinant Human GADD45A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Gadd45a-3130M | Recombinant Mouse Gadd45a Protein, Myc/DDK-tagged | +Inquiry |
GADD45A-26075TH | Recombinant Human GADD45A, His-tagged | +Inquiry |
GADD45A-146H | Recombinant Full Length Human growth arrest and DNA-damage-inducible, alpha Protein, His&Flag&StrepII tagged | +Inquiry |
GADD45A-3880H | Recombinant Human GADD45A protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GADD45A Products
Required fields are marked with *
My Review for All GADD45A Products
Required fields are marked with *
0
Inquiry Basket