Recombinant Human GADD45A protein, His-SUMO-tagged

• Cat.No.: GADD45A-2936H
• Product Overview: Recombinant Human GADD45A protein(P24522)(1-165aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-165aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.3 kDa
• AA Sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ]
• Official Symbol: GADD45A
• Synonyms: GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha
• Gene ID: 1647
• mRNA Refseq: NM_001199741
• Protein Refseq: NP_001186670
• MIM: 126335
• UniProt ID: P24522