Recombinant Human GADD45A protein, His-SUMO-tagged
Cat.No. : | GADD45A-2936H |
Product Overview : | Recombinant Human GADD45A protein(P24522)(1-165aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-165aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.3 kDa |
AA Sequence : | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ] |
Official Symbol | GADD45A |
Synonyms | GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; |
Gene ID | 1647 |
mRNA Refseq | NM_001199741 |
Protein Refseq | NP_001186670 |
MIM | 126335 |
UniProt ID | P24522 |
◆ Recombinant Proteins | ||
GADD45A-1619R | Recombinant Rhesus Macaque GADD45A Protein, His (Fc)-Avi-tagged | +Inquiry |
GADD45A-3880H | Recombinant Human GADD45A protein, His&GST-tagged | +Inquiry |
GADD45A-5206HF | Recombinant Full Length Human GADD45A Protein, GST-tagged | +Inquiry |
GADD45A-1798R | Recombinant Rhesus monkey GADD45A Protein, His-tagged | +Inquiry |
GADD45A-3439M | Recombinant Mouse GADD45A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GADD45A Products
Required fields are marked with *
My Review for All GADD45A Products
Required fields are marked with *
0
Inquiry Basket