Recombinant Human GADD45A protein, His-SUMO-tagged
| Cat.No. : | GADD45A-2936H |
| Product Overview : | Recombinant Human GADD45A protein(P24522)(1-165aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-165aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.3 kDa |
| AA Sequence : | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ] |
| Official Symbol | GADD45A |
| Synonyms | GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; |
| Gene ID | 1647 |
| mRNA Refseq | NM_001199741 |
| Protein Refseq | NP_001186670 |
| MIM | 126335 |
| UniProt ID | P24522 |
| ◆ Recombinant Proteins | ||
| GADD45A-3482H | Recombinant Human GADD45A protein, His-tagged | +Inquiry |
| GADD45A-13109H | Recombinant Human GADD45A protein, GST-tagged | +Inquiry |
| Gadd45a-1558R | Recombinant Rat Gadd45a Protein, His-tagged | +Inquiry |
| GADD45A-2936H | Recombinant Human GADD45A protein, His-SUMO-tagged | +Inquiry |
| GADD45A-6162M | Recombinant Mouse GADD45A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45A Products
Required fields are marked with *
My Review for All GADD45A Products
Required fields are marked with *
