Recombinant Full Length Human GAGE1 Protein
Cat.No. : | GAGE1-189HF |
Product Overview : | Recombinant full length Human GAGE1 (amino acids 1-138) with N terminal proprietary tag, 41.36kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 138 amino acids |
Description : | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | 41.360kDa inclusive of tags |
AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPAT PEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQG HPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQT GILWLLMNNCFLNLSPRKP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GAGE1 G antigen 1 [ Homo sapiens ] |
Official Symbol | GAGE1 |
Synonyms | GAGE1; G antigen 1; cancer/testis antigen family 4; member 1; CT4.1 |
Gene ID | 2543 |
mRNA Refseq | NM_001040663 |
Protein Refseq | NP_001035753 |
MIM | 300594 |
UniProt ID | Q13065 |
◆ Recombinant Proteins | ||
GAGE1-5211HF | Recombinant Full Length Human GAGE1 Protein, GST-tagged | +Inquiry |
GAGE1-26549TH | Recombinant Human GAGE1 | +Inquiry |
GAGE1-189HF | Recombinant Full Length Human GAGE1 Protein | +Inquiry |
GAGE1-4663H | Recombinant Human GAGE1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAGE1-6051HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
GAGE1-6050HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE1 Products
Required fields are marked with *
My Review for All GAGE1 Products
Required fields are marked with *