Recombinant Full Length Human GAGE1 Protein

Cat.No. : GAGE1-189HF
Product Overview : Recombinant full length Human GAGE1 (amino acids 1-138) with N terminal proprietary tag, 41.36kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 138 amino acids
Description : This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 41.360kDa inclusive of tags
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPAT PEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQG HPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQT GILWLLMNNCFLNLSPRKP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GAGE1 G antigen 1 [ Homo sapiens ]
Official Symbol GAGE1
Synonyms GAGE1; G antigen 1; cancer/testis antigen family 4; member 1; CT4.1
Gene ID 2543
mRNA Refseq NM_001040663
Protein Refseq NP_001035753
MIM 300594
UniProt ID Q13065

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAGE1 Products

Required fields are marked with *

My Review for All GAGE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon