Recombinant Human GAGE1
Cat.No. : | GAGE1-26549TH |
Product Overview : | Recombinant full length Human GAGE1 (amino acids 1-138) with N terminal proprietary tag, 41.36kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants. |
Protein length : | 138 amino acids |
Molecular Weight : | 41.360kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPAT PEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQG HPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQT GILWLLMNNCFLNLSPRKP |
Gene Name : | GAGE1 G antigen 1 [ Homo sapiens ] |
Official Symbol : | GAGE1 |
Synonyms : | GAGE1; G antigen 1; cancer/testis antigen family 4; member 1; CT4.1; |
Gene ID : | 2543 |
mRNA Refseq : | NM_001040663 |
Protein Refseq : | NP_001035753 |
MIM : | 300594 |
Uniprot ID : | Q13065 |
Chromosome Location : | Xp11.23 |
Products Types
◆ Recombinant Protein | ||
GAGE1-4663H | Recombinant Human GAGE1 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
GAGE1-6051HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
GAGE1-6050HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket