Recombinant Full Length Human GAGE1 Protein, GST-tagged

Cat.No. : GAGE1-5211HF
Product Overview : Human GAGE1 full-length ORF ( NP_001459.2, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 139 amino acids
Description : This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq
Molecular Mass : 42 kDa
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAGE1 G antigen 1 [ Homo sapiens ]
Official Symbol GAGE1
Synonyms CT4.1; GAGE-1; GAGE1; G antigen 1; G Antigen 1; Cancer/Testis Antigen Family 4, Member 1; Cancer/Testis Antigen 4.1; CT4.1; MZ2-F Antigen; Antigen MZ2-F
Gene ID 2543
mRNA Refseq NM_001468
Protein Refseq NP_001459
MIM 300594
UniProt ID Q13065

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAGE1 Products

Required fields are marked with *

My Review for All GAGE1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon