Recombinant Full Length Human GALM Protein, GST-tagged
Cat.No. : | GALM-5139HF |
Product Overview : | Human GALM full-length ORF ( NP_620156.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 342 amino acids |
Description : | This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ] |
Official Symbol | GALM |
Synonyms | GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase; galactomutarotase; IBD1; BLOCK25; |
Gene ID | 130589 |
mRNA Refseq | NM_138801 |
Protein Refseq | NP_620156 |
MIM | 608883 |
UniProt ID | Q96C23 |
◆ Recombinant Proteins | ||
GALM-3003H | Recombinant Human GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
GALM-5139HF | Recombinant Full Length Human GALM Protein, GST-tagged | +Inquiry |
GALM-2119R | Recombinant Rat GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
GALM-517Z | Recombinant Zebrafish GALM | +Inquiry |
GALM-911H | Recombinant Human GALM | +Inquiry |
◆ Native Proteins | ||
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALM-6041HCL | Recombinant Human GALM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALM Products
Required fields are marked with *
My Review for All GALM Products
Required fields are marked with *